Structure of PDB 1elw Chain B Binding Site BS01

Receptor Information
>1elw Chain B (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAK
KGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLK
HEANNPQLKEGLQNM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1elw Structure of TPR domain-peptide complexes: critical elements in the assembly of the Hsp70-Hsp90 multichaperone machine
Resolution1.6 Å
Binding residue
(original residue number in PDB)		K8 N12 N43 K73 S76 R77 E83 F84 Q107
Binding residue
(residue number reindexed from 1)		K8 N12 N43 K73 S76 R77 E83 F84 Q107
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1elw, PDBe:1elw, PDBj:1elw
PDBsum1elw
PubMed10786835
UniProtP31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 (Gene Name=STIP1)

[Back to BioLiP]