Structure of PDB 1ekb Chain B Binding Site BS01

Receptor Information
>1ekb Chain B (length=235) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDWLVSAAHCVYGRNMEP
SKWKAVLGLHMASNLTSPQIETRLIDQIVINPHYNKRRKNNDIAMMHLEM
KVNYTDYIQPICLPEENQVFPPGRICSIAGWGALIYQGSTADVLQEADVP
LLSNEKCQQQMPEYNITENMVCAGYEAGGVDSCQGDSGGPLMCQENNRWL
LAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFLH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ekb Crystal structure of enteropeptidase light chain complexed with an analog of the trypsinogen activation peptide.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		A26 W27 W29 D116 P120 C122 R206 W207
Binding residue
(residue number reindexed from 1)		A11 W12 W14 D106 P110 C112 R198 W199
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H41 D92 Q184 G185 D186 S187 G188
Enzyme Commision number 3.4.21.9: enteropeptidase.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ekb, PDBe:1ekb, PDBj:1ekb
PDBsum1ekb
PubMed10493881
UniProtP98072|ENTK_BOVIN Enteropeptidase (Gene Name=TMPRSS15)

[Back to BioLiP]