Structure of PDB 1eba Chain B Binding Site BS01

Receptor Information

>1eba Chain B (length=207) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQL
EDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRY
HRVIHINEVVLLDAPVGLVARLASGHVVLRWLPPPETPMTSHIRYEVDVS
AGNGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWS
EPVSLLT

Ligand information

>1eba Chain C (length=16) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TYSCHFGPLTWVCKPQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1eba An antagonist peptide-EPO receptor complex suggests that receptor dimerization is not sufficient for activation.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	S91 S92 F93
Binding residue (residue number reindexed from 1)	S82 S83 F84

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004896	cytokine receptor activity

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:1eba, PDBe:1eba, PDBj:1eba
PDBsum	1eba
PubMed	9808045
UniProt	P19235\|EPOR_HUMAN Erythropoietin receptor (Gene Name=EPOR)

[Back to BioLiP]