Structure of PDB 1e7k Chain B Binding Site BS01

Receptor Information

>1e7k Chain B (length=123) Species: 9606 (Homo sapiens)

VNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIV
MAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVT
IKEGSQLKQQIQSIQQSIERLLV

Ligand information

>1e7k Chain D (length=17)

gccaaugaggccgaggc

<<<.....<<>>..>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1e7k Crystal Structure of the Spliceosomal 15.5Kd Protein Bound to a U4 Snrna Fragment
• Resolution: 2.9 Å
• Binding residue (original residue number in PDB): K37 G38 A39 N40 E41 K44 R48 E61 K86 R97 I100
• Binding residue (residue number reindexed from 1): K32 G33 A34 N35 E36 K39 R43 E56 K81 R92 I95

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030515 snoRNA binding
• GO:0030621 U4 snRNA binding
• GO:0030622 U4atac snRNA binding
• GO:0034511 U3 snoRNA binding
• GO:0034512 box C/D sno(s)RNA binding
• GO:0051117 ATPase binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0000492 box C/D snoRNP assembly
• GO:0006397 mRNA processing
• GO:0007338 single fertilization
• GO:0008380 RNA splicing
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0001651 dense fibrillar component
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005690 U4atac snRNP
• GO:0005730 nucleolus
• GO:0031428 box C/D methylation guide snoRNP complex
• GO:0032040 small-subunit processome
• GO:0032991 protein-containing complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071011 precatalytic spliceosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1e7k, PDBe:1e7k, PDBj:1e7k
• PDBsum: 1e7k
• PubMed: 11163207
• UniProt: P55769|NH2L1_HUMAN NHP2-like protein 1 (Gene Name=SNU13)