Structure of PDB 1dzj Chain B Binding Site BS01

Receptor Information

>1dzj Chain B (length=148) Species: 9823 (Sus scrofa)

FELSGKWITSYIGSSDLEKIGENAPFQVFMRSIEFDDKESKVYLNFFSKE
NGICEEFSLIGTKQEGNTYDVNYAGNNKFVVSYASETALIISNINVDEEG
DKTIMTGLLGKGTDIEDQDLEKFKEVTRENGIPEENIVNIIERDDCPA

Ligand information

• Ligand ID: SES
• InChI: InChI=1S/C10H18N2Se/c1-3-5-7-8-9(6-4-2)13-10(11)12-8/h3-7H2,1-2H3,(H2,11,12)
• InChIKey: DOUUMUUUWUAPPC-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04: n1c(c([se]c1N)CCC)CCCC
  CACTVS 3.341: CCCCc1nc(N)[se]c1CCC
  OpenEye OEToolkits 1.5.0: CCCCc1c([se]c(n1)N)CCC
• Formula: C10 H18 N2 Se
• Name: 4-butyl-5-propyl-1,3-selenazol-2-amine
• ChEMBL: CHEMBL1235902
• DrugBank: DB01740
• PDB chain: 1dzj Chain B Residue 700

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1dzj Complexes of Porcine Odorant Binding Protein with Odorant Molecules Belonging to Different Chemical Classes
• Resolution: 2.0 Å
• Binding residue (original residue number in PDB): V37 F55 I100 N102 T115 G116
• Binding residue (residue number reindexed from 1): V28 F46 I91 N93 T106 G107
• Annotation score: 1
• Binding affinity: MOAD: ic50=1.3uM

Gene Ontology

Molecular Function

• GO:0005549 odorant binding
• GO:0036094 small molecule binding

Biological Process

• GO:0007608 sensory perception of smell

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space

External links

• PDB: RCSB:1dzj, PDBe:1dzj, PDBj:1dzj
• PDBsum: 1dzj
• PubMed: 10864504
• UniProt: P81245|OBP_PIG Odorant-binding protein