Structure of PDB 1dz5 Chain B Binding Site BS01

Receptor Information
>1dz5 Chain B (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKM
RGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTF
V
Ligand information
>1dz5 Chain C (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gagacauugcacccggagucuc
......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1dz5 The NMR Structure of the 38kDa U1A Protein-Pie RNA Complex Reveals the Basis of Cooperativity in Regulation of Polyadenylation by Human U1A Protein
ResolutionN/A
Binding residue
(original residue number in PDB)
T5 Y12 N15 E18 L43 L48 K49 M50 R51 G52 Q53 F55 Y85 A86 K87 T88 D89 S90 D91
Binding residue
(residue number reindexed from 1)
T5 Y12 N15 E18 L43 L48 K49 M50 R51 G52 Q53 F55 Y85 A86 K87 T88 D89 S90 D91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1dz5, PDBe:1dz5, PDBj:1dz5
PDBsum1dz5
PubMed10742179
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]