Structure of PDB 1du0 Chain B Binding Site BS01

Receptor Information

>1du0 Chain B (length=56) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFANK
RAKIKK

Ligand information

>1du0 Chain C (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttttgccatgtaattacctaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1du0 Exploring the role of glutamine 50 in the homeodomain-DNA interface: crystal structure of engrailed (Gln50 --> ala) complex at 2.0 A.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	Y125 E128 R131 R153 K157
Binding residue (residue number reindexed from 1)	Y23 E26 R29 R51 K55
Binding affinity	PDBbind-CN: Kd=79pM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1du0, PDBe:1du0, PDBj:1du0
PDBsum	1du0
PubMed	10889025
UniProt	P02836\|HMEN_DROME Segmentation polarity homeobox protein engrailed (Gene Name=en)

[Back to BioLiP]