Structure of PDB 1ds5 Chain B Binding Site BS01

Receptor Information

>1ds5 Chain B (length=328) Species: 4577 (Zea mays)

MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFE
GINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQH
SKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHR
DVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVD
LQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLN
VYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLL
RYDHQERLTALEAMTHPYFQQVRAAENS

Ligand information

>1ds5 Chain E (length=16) Species: 9606 (Homo sapiens)

YGFKIHPMAYQLQLQA

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1ds5 The crystal structure of the complex of Zea mays alpha subunit with a fragment of human beta subunit provides the clue to the architecture of protein kinase CK2 holoenzyme.
• Resolution: 3.16 Å
• Binding residue (original residue number in PDB): Q36 Y39 E40 V41 F54 I57 I67 I69 D103
• Binding residue (residue number reindexed from 1): Q31 Y34 E35 V36 F49 I52 I62 I64 D98

Enzymatic activity

• Catalytic site (original residue number in PDB): D156 K158 N161 D175 S194
• Catalytic site (residue number reindexed from 1): D151 K153 N156 D170 S189
• Enzyme Commision number: 2.7.11.1: non-specific serine/threonine protein kinase.

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004674 protein serine/threonine kinase activity
• GO:0005524 ATP binding
• GO:0044024 histone H2AS1 kinase activity
• GO:0106310 protein serine kinase activity

Biological Process

• GO:0006338 chromatin remodeling
• GO:0006468 protein phosphorylation
• GO:0016310 phosphorylation
• GO:0051726 regulation of cell cycle

Cellular Component

• GO:0005634 nucleus
• GO:0005829 cytosol
• GO:0005956 protein kinase CK2 complex
• GO:0043231 intracellular membrane-bounded organelle

External links

• PDB: RCSB:1ds5, PDBe:1ds5, PDBj:1ds5
• PDBsum: 1ds5
• PubMed: 10931203
• UniProt: P28523|CSK2A_MAIZE Casein kinase II subunit alpha (Gene Name=ACK2)