Structure of PDB 1dfm Chain B Binding Site BS01

Receptor Information
>1dfm Chain B (length=218) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKIDITDYNHADEILNPQLWKEIEETLLKMPLHVKASDQASKVGSLIFDP
VGTNQYIKDELVPKHWKNNIPIPKRFDFLGTDIDFGKRDTLVEVQFSNYP
FLLNNTVRSELFHKSNMDIDEEGMKVAIIITKGHMFPASNSSLYYEQAQN
QLNSLAEYNVFDVPIRLVGLIEDFETDIDIVSTTYADKRYSRTITKRDTV
KGKVIDTNTRKRGTIVTY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1dfm Understanding the immutability of restriction enzymes: crystal structure of BglII and its DNA substrate at 1.5 A resolution.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		Y99 H134 N140 S141 Y144 Y190 R192
Binding residue
(residue number reindexed from 1)		Y99 H134 N140 S141 Y144 Y190 R192
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1dfm, PDBe:1dfm, PDBj:1dfm
PDBsum1dfm
PubMed10655616
UniProtQ45488|T2B2_BACIU Type II restriction enzyme BglII (Gene Name=bglIIR)

[Back to BioLiP]