Structure of PDB 1d8t Chain B Binding Site BS01

Receptor Information

>1d8t Chain B (length=385) Species: 562 (Escherichia coli)

KPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKAR
GITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAAT
DGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLS
QYDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPERAIDK
PFLLPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIKETQKSTCTGV
EMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEV
YILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKM
VVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG

Ligand information

>1d8t Chain D (length=14) Species: 35762 (Planobispora rosea)

SCNCVCGFCCSCSP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1d8t Structure of an EF-TU Complex with a Thiazolyl Peptide Antibiotic Determined at 2.35 A Resolution: Atomic Basis for Ge2270A Inhibition of EF-TU.
• Resolution: 2.35 Å
• Binding residue (original residue number in PDB): E215 D216 F218 R223 V226 T228 G229 T256 G257 E259 F261 R262 L264 N273 V274 G275 L277
• Binding residue (residue number reindexed from 1): E207 D208 F210 R215 V218 T220 G221 T248 G249 E251 F253 R254 L256 N265 V266 G267 L269

Enzymatic activity

• Catalytic site (original residue number in PDB): D21 K24 T25 T61 H84
• Catalytic site (residue number reindexed from 1): D13 K16 T17 T53 H76

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0097216 guanosine tetraphosphate binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0032045 guanyl-nucleotide exchange factor complex

External links

• PDB: RCSB:1d8t, PDBe:1d8t, PDBj:1d8t
• PDBsum: 1d8t
• PubMed: 10625477
• UniProt: P0CE47|EFTU1_ECOLI Elongation factor Tu 1 (Gene Name=tufA)