Structure of PDB 1d6e Chain B Binding Site BS01

Receptor Information
>1d6e Chain B (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTE
LGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVY
PALLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVML
ETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1d6e Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
Resolution2.45 Å
Binding residue
(original residue number in PDB)
H13 Y30 W61 T77 Y78 H81 N82 V85
Binding residue
(residue number reindexed from 1)
H11 Y28 W59 T75 Y76 H79 N80 V83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1d6e, PDBe:1d6e, PDBj:1d6e
PDBsum1d6e
PubMed10841792
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]