Structure of PDB 1d5y Chain B Binding Site BS01

Receptor Information

>1d5y Chain B (length=288) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QAGIIRDLLIWLEGHLDQPLSLDNVAAKAGYSKWHLQRMFKDVTGHAIGA
YIRARRLSKSAVALRLTARPILDIALQYRFDSQQTFTRAFKKQFAQTPAL
YRRSPEWSAFGIRPPLRLGEFTMPEHKFVTLEDTPLIGVTQSYSCSLEQI
SDFRHEMRYQFWHDFLGNAPTIPPVLYGLNETRPSQDKDDEQEVFYTTAL
AQDQADGYVLTGHPVMLQGGEYVMFTYEGLGTGVQEFILTVYGTCMPMLN
LTRRKGQDIERYYPAEDDRPINLRCELLIPIRRKLAAA

Ligand information

>1d5y Chain M (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgacagcactgaatgtcaaag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1d5y Crystal structure of the Escherichia coli Rob transcription factor in complex with DNA.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	R90 K94
Binding residue (residue number reindexed from 1)	R88 K92

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1d5y, PDBe:1d5y, PDBj:1d5y
PDBsum	1d5y
PubMed	10802742
UniProt	P0ACI0\|ROB_ECOLI Right origin-binding protein (Gene Name=rob)

[Back to BioLiP]