Structure of PDB 1d5h Chain B Binding Site BS01

Receptor Information
>1d5h Chain B (length=101) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCY
QSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDAS
V
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1d5h Thermodynamic and structural studies of cavity formation in proteins suggest that loss of packing interactions rather than the hydrophobic effect dominates the observed energetics.
Resolution2.25 Å
Binding residue
(original residue number in PDB)
Y25 R33 K41 N44 T45 F46 V47 H48 E49 L51 F120
Binding residue
(residue number reindexed from 1)
Y2 R10 K18 N21 T22 F23 V24 H25 E26 L28 F97
Enzymatic activity
Catalytic site (original residue number in PDB) K41 H119 F120 D121
Catalytic site (residue number reindexed from 1) K18 H96 F97 D98
Enzyme Commision number 4.6.1.18: pancreatic ribonuclease.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:1d5h, PDBe:1d5h, PDBj:1d5h
PDBsum1d5h
PubMed11015216
UniProtP61823|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)

[Back to BioLiP]