Structure of PDB 1d4w Chain B Binding Site BS01

Receptor Information

>1d4w Chain B (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIY
TYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPV
EK

Ligand information

>1d4w Chain D (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SLTIYAQVQK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1d4w Crystal structures of the XLP protein SAP reveal a class of SH2 domains with extended, phosphotyrosine-independent sequence recognition.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	R13 E17 R32 S34 E35 S36 C42 Y50 I51 T53 Y54 R55 E67 T68 A69 V72 R75 D91 G93
Binding residue (residue number reindexed from 1)	R11 E15 R30 S32 E33 S34 C40 Y48 I49 T51 Y52 R53 E65 T66 A67 V70 R73 D89 G91

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006968	cellular defense response
GO:0007267	cell-cell signaling

	Cellular Component
GO:0005737	cytoplasm

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1d4w, PDBe:1d4w, PDBj:1d4w
PDBsum	1d4w
PubMed	10549287
UniProt	O60880\|SH21A_HUMAN SH2 domain-containing protein 1A (Gene Name=SH2D1A)

[Back to BioLiP]