Structure of PDB 1d3u Chain B Binding Site BS01

Receptor Information
>1d3u Chain B (length=201) Species: 2262 (Pyrococcus woesei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVSDAAERNLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGR
SIESVMAACVYAACRLLKVPRTLDEIADIARVDKKEIGRSYRFIARNLNL
TPKKLFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYKRGLTSGKSPAG
LVAAALYIASLLEGEKRTQREVAEVARVTEVTVRNRYKELVEKLKIKVPI
A
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1d3u The structural basis for the oriented assembly of a TBP/TFB/promoter complex.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R1147 K1184 R1188 Y1256 K1265 T1267 Q1268 V1280 R1283 K1287 A1300
Binding residue
(residue number reindexed from 1)		R48 K85 R89 Y157 K166 T168 Q169 V181 R184 K188 A201
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0017025 TBP-class protein binding
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0070897 transcription preinitiation complex assembly

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1d3u, PDBe:1d3u, PDBj:1d3u
PDBsum1d3u
PubMed10570130
UniProtP61999|TF2B_PYRWO Transcription initiation factor IIB (Gene Name=tfb)

[Back to BioLiP]