Structure of PDB 1cyq Chain B Binding Site BS01

Receptor Information
>1cyq Chain B (length=162) Species: 5791 (Physarum polycephalum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYG
VGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASALCH
NTRCHNPLHLCWESLDDNKGRNWCPGPNGGCVHAVVCLRQGPLYGPGATV
AGPQQRGSHFVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cyq A novel endonuclease mechanism directly visualized for I-PpoI.
Resolution1.93 Å
Binding residue
(original residue number in PDB)		N257 R261 Q263 R274 T279 T295 A296 A298 N319 N323
Binding residue
(residue number reindexed from 1)		N56 R60 Q62 R73 T78 T94 A95 A97 N118 N122
Enzymatic activity
Catalytic site (original residue number in PDB) N319
Catalytic site (residue number reindexed from 1) N118
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cyq, PDBe:1cyq, PDBj:1cyq
PDBsum1cyq
PubMed10581547
UniProtQ94702|PPO1_PHYPO Intron-encoded endonuclease I-PpoI

[Back to BioLiP]