Structure of PDB 1cjg Chain B Binding Site BS01

Receptor Information
>1cjg Chain B (length=62) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPN
RVAQQLAGKQSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cjg The solution structure of Lac repressor headpiece 62 complexed to a symmetrical lac operator.
ResolutionN/A
Binding residue
(original residue number in PDB)		T5 L6 Y7 N25 Y47 P49 N50 A53 A57
Binding residue
(residue number reindexed from 1)		T5 L6 Y7 N25 Y47 P49 N50 A53 A57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cjg, PDBe:1cjg, PDBj:1cjg
PDBsum1cjg
PubMed10647179
UniProtP03023|LACI_ECOLI Lactose operon repressor (Gene Name=lacI)

[Back to BioLiP]