Structure of PDB 1cf7 Chain B Binding Site BS01

Receptor Information
>1cf7 Chain B (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQK
NIRRRVYDALNVLMAMNIISKEKKEIKWIGLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cf7 Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R121 Y124 N128 K141
Binding residue
(residue number reindexed from 1)		R54 Y57 N61 K74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1cf7, PDBe:1cf7, PDBj:1cf7
PDBsum1cf7
PubMed10090723
UniProtQ14188|TFDP2_HUMAN Transcription factor Dp-2 (Gene Name=TFDP2)

[Back to BioLiP]