Structure of PDB 1c9b Chain B Binding Site BS01

Receptor Information

>1c9b Chain B (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREP
RTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQN
MVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVS
GKVVLTGAKVRAEIYEAFENIYPILKGFRK

Ligand information

>1c9b Chain C (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gggcgcctataaaagggg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1c9b Structural basis of preinitiation complex assembly on human pol II promoters.
Resolution	2.65 Å
Binding residue (original residue number in PDB)	V169 F214 S216 K218 V220 Q256 N257 F288 R294 L303 T313
Binding residue (residue number reindexed from 1)	V12 F57 S59 K61 V63 Q99 N100 F131 R137 L146 T156

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006352	DNA-templated transcription initiation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1c9b, PDBe:1c9b, PDBj:1c9b
PDBsum	1c9b
PubMed	10619841
UniProt	P20226\|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]