Structure of PDB 1by4 Chain B Binding Site BS01

Receptor Information
>1by4 Chain B (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDC
LIDKRQRNRCQYCRYQKCLAMGMKREAVQEER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1by4 Structural basis of RXR-DNA interactions.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		K1245 H1246 R1264 Q1306 R1309
Binding residue
(residue number reindexed from 1)		K18 H19 R37 Q79 R82
Binding affinityPDBbind-CN: Kd=350nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1by4, PDBe:1by4, PDBj:1by4
PDBsum1by4
PubMed10669605
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]