Structure of PDB 1bx2 Chain B Binding Site BS01

Receptor Information

>1bx2 Chain B (length=191) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTE
LGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVY
PSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGD
WTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE

Ligand information

>1bx2 Chain C (length=14) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ENPVVHFFKNIVTP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1bx2 Crystal structure of HLA-DR2 (DRA0101, DRB11501) complexed with a peptide from human myelin basic protein.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	R13 F26 Q70 Y78 H81 N82
Binding residue (residue number reindexed from 1)	R11 F24 Q68 Y76 H79 N80

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1bx2, PDBe:1bx2, PDBj:1bx2
PDBsum	1bx2
PubMed	9782128
UniProt	P01911\|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]