Structure of PDB 1bsz Chain B Binding Site BS01

Receptor Information

>1bsz Chain B (length=168) Species: 83333 (Escherichia coli K-12)

SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQ
VDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALV
PRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLK
QQRIRQKVEKLDRLKARA

Ligand information

• Ligand ID: FE
• InChI: InChI=1S/Fe/q+3
• InChIKey: VTLYFUHAOXGGBS-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Fe+3]
• Formula: Fe
• Name: FE (III) ION
• DrugBank: DB13949
• PDB chain: 1bsz Chain B Residue 2002

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1bsz Iron center, substrate recognition and mechanism of peptide deformylase.
• Resolution: 1.9 Å
• Binding residue (original residue number in PDB): Q550 C590 H632 H636
• Binding residue (residue number reindexed from 1): Q50 C90 H132 H136
• Annotation score: 1

Enzymatic activity

• Catalytic site (original residue number in PDB): G545 Q550 C590 L591 H632 E633 H636
• Catalytic site (residue number reindexed from 1): G45 Q50 C90 L91 H132 E133 H136
• Enzyme Commision number: 3.5.1.88: peptide deformylase.

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008198 ferrous iron binding
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0042586 peptide deformylase activity
• GO:0043022 ribosome binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation
• GO:0043686 co-translational protein modification

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:1bsz, PDBe:1bsz, PDBj:1bsz
• PDBsum: 1bsz
• PubMed: 9846875
• UniProt: P0A6K3|DEF_ECOLI Peptide deformylase (Gene Name=def)