Structure of PDB 1bsx Chain B Binding Site BS01

Receptor Information

>1bsx Chain B (length=243) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPKVDLEA
FSHFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAA
VRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDT
EVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFW
PKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED

Ligand information

>1bsx Chain Y (length=12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HKILHRLLQDSS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1bsx Structure and specificity of nuclear receptor-coactivator interactions.
Resolution	3.7 Å
Binding residue (original residue number in PDB)	V284 K288 I302 E457
Binding residue (residue number reindexed from 1)	V66 K70 I84 E239

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1bsx, PDBe:1bsx, PDBj:1bsx
PDBsum	1bsx
PubMed	9808622
UniProt	P10828\|THB_HUMAN Thyroid hormone receptor beta (Gene Name=THRB)

[Back to BioLiP]