Structure of PDB 1bs6 Chain B Binding Site BS01

Receptor Information
>1bs6 Chain B (length=168) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQ
VDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALV
PRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLK
QQRIRQKVEKLDRLKARA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bs6 Iron center, substrate recognition and mechanism of peptide deformylase.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		E542 G543 I544 G545 G589 R597 I628 C629 H632
Binding residue
(residue number reindexed from 1)		E42 G43 I44 G45 G89 R97 I128 C129 H132
Enzymatic activity
Catalytic site (original residue number in PDB) G545 Q550 C590 L591 H632 E633 H636
Catalytic site (residue number reindexed from 1) G45 Q50 C90 L91 H132 E133 H136
Enzyme Commision number 3.5.1.88: peptide deformylase.
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008198 ferrous iron binding
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0042586 peptide deformylase activity
GO:0043022 ribosome binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
GO:0043686 co-translational protein modification
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bs6, PDBe:1bs6, PDBj:1bs6
PDBsum1bs6
PubMed9846875
UniProtP0A6K3|DEF_ECOLI Peptide deformylase (Gene Name=def)

[Back to BioLiP]