Structure of PDB 1bgb Chain B Binding Site BS01

Receptor Information
>1bgb Chain B (length=228) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLRSDLINALDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEK
HGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKIKFTLGGYTS
FIRNNTKNIVYPFDQYIAHWIIGYVYTRVSLKTYNINELNEIPKPYKGVK
VFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWR
NYERTSQLRNDKYNNISEYRNWIYRGRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bgb Recognition of flanking DNA sequences by EcoRV endonuclease involves alternative patterns of water-mediated contacts.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		N70 K92 T93 T94 Y95 T106 G109 T111 S112 S183 T186
Binding residue
(residue number reindexed from 1)		N62 K84 T85 T86 Y87 T94 G97 T99 S100 S166 T169
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1bgb, PDBe:1bgb, PDBj:1bgb
PDBsum1bgb
PubMed9705308
UniProtP04390|T2E5_ECOLX Type II restriction enzyme EcoRV (Gene Name=ecoRVR)

[Back to BioLiP]