Structure of PDB 1bcs Chain B Binding Site BS01

Receptor Information
>1bcs Chain B (length=153) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAP
RSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYP
WYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPM
PGQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bcs Peptide aldehyde complexes with wheat serine carboxypeptidase II: implications for the catalytic mechanism and substrate specificity.
Resolution2.08 Å
Binding residue
(original residue number in PDB)		C303 D303B N306 H397
Binding residue
(residue number reindexed from 1)		C38 D40 N43 H127
Enzymatic activity
Catalytic site (original residue number in PDB) D338 H397
Catalytic site (residue number reindexed from 1) D75 H127
Enzyme Commision number 3.4.16.6: carboxypeptidase D.
Gene Ontology
Molecular Function
GO:0004185 serine-type carboxypeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1bcs, PDBe:1bcs, PDBj:1bcs
PDBsum1bcs
PubMed8636973
UniProtP08819|CBP2_WHEAT Serine carboxypeptidase 2 (Gene Name=CBP2)

[Back to BioLiP]