Structure of PDB 1b8i Chain B Binding Site BS01

Receptor Information
>1b8i Chain B (length=58) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGN
KRIRYKKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1b8i Structure of a DNA-bound Ultrabithorax-Extradenticle homeodomain complex.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R205 Y228 R256 I257
Binding residue
(residue number reindexed from 1)		R1 Y24 R52 I53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1b8i, PDBe:1b8i, PDBj:1b8i
PDBsum1b8i
PubMed10067897
UniProtP40427|EXD_DROME Homeobox protein extradenticle (Gene Name=exd)

[Back to BioLiP]