Structure of PDB 1b7f Chain B Binding Site BS01

Receptor Information
>1b7f Chain B (length=167) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSYGYAFVD
FTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTI
TDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL
NNVIPEGGSQPLSVRLA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1b7f Structural basis for recognition of the tra mRNA precursor by the Sex-lethal protein.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		N126 N130 Y131 R155 M157 R158 D159 Y160 Y166 Y168 F170 K194 R195 K197 R202 G204 Y214 T216 N241 L243 R252 V254 F256 R258
Binding residue
(residue number reindexed from 1)		N4 N8 Y9 R33 M35 R36 D37 Y38 Y44 Y46 F48 K72 R73 K75 R80 G82 Y92 T94 N119 L121 R130 V132 F134 R136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Cellular Component
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1b7f, PDBe:1b7f, PDBj:1b7f
PDBsum1b7f
PubMed10217141
UniProtP19339|SXL_DROME Protein sex-lethal (Gene Name=Sxl)

[Back to BioLiP]