Structure of PDB 1b72 Chain B Binding Site BS01

Receptor Information
>1b72 Chain B (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWF
GNKRIRYKKNIGKFQEEANIYAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1b72 Structure of a HoxB1-Pbx1 heterodimer bound to DNA: role of the hexapeptide and a fourth homeodomain helix in complex formation.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		R237 Q279 N282 N286 R290
Binding residue
(residue number reindexed from 1)		R3 Q45 N48 N52 R56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1b72, PDBe:1b72, PDBj:1b72
PDBsum1b72
PubMed10052460
UniProtP40424|PBX1_HUMAN Pre-B-cell leukemia transcription factor 1 (Gene Name=PBX1)

[Back to BioLiP]