Structure of PDB 1b17 Chain B Binding Site BS01

Receptor Information
>1b17 Chain B (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1b17 Crystallographic titration of cubic insulin crystals: pH affects GluB13 switching and sulfate binding.
Resolution1.7 Å
Binding residue
(original residue number in PDB)
V2 N3 Q4 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25
Binding residue
(residue number reindexed from 1)
V2 N3 Q4 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:1b17, PDBe:1b17, PDBj:1b17
PDBsum1b17
PubMed12657786
UniProtP01315|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]