Structure of PDB 1aya Chain B Binding Site BS01

Receptor Information
>1aya Chain B (length=101) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVT
HIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPL
N
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1aya Crystal structures of peptide complexes of the amino-terminal SH2 domain of the Syp tyrosine phosphatase.
Resolution2.05 Å
Binding residue
(original residue number in PDB)
E17 R32 S34 K35 S36 T42 T52 H53 L88 K89
Binding residue
(residue number reindexed from 1)
E15 R30 S32 K33 S34 T40 T50 H51 L86 K87
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:1aya, PDBe:1aya, PDBj:1aya
PDBsum1aya
PubMed7521735
UniProtP35235|PTN11_MOUSE Tyrosine-protein phosphatase non-receptor type 11 (Gene Name=Ptpn11)

[Back to BioLiP]