Structure of PDB 1axd Chain B Binding Site BS01

Receptor Information
>1axd Chain B (length=209) Species: 4577 (Zea mays) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APMKLYGAVMSWNLTRCATALEEAGSDYEIVPINFATAEHKSPEHLVRNP
FGQVPALQDGDLYLFESRAICKYAARKNKPELLREGNLEEAAMVDVWIEV
EANQYTAALNPILFQVLISPMLGGTTDQKVVDENLEKLKKVLEVYEARLT
KCKYLAGDFLSLADLNHVSVTLCLFATPYASVLDAYPHVKAWWSGLMERP
SVQKVAALM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1axd Crystal structure of herbicide-detoxifying maize glutathione S-transferase-I in complex with lactoylglutathione: evidence for an induced-fit mechanism.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		S11 N13 F35 H40 K41 Q53 V54 E66 S67
Binding residue
(residue number reindexed from 1)		S11 N13 F35 H40 K41 Q53 V54 E66 S67
Enzymatic activity
Enzyme Commision number 2.5.1.18: glutathione transferase.
Gene Ontology
Molecular Function
GO:0004364 glutathione transferase activity
GO:0016740 transferase activity
GO:0043295 glutathione binding
Biological Process
GO:0000302 response to reactive oxygen species
GO:0006749 glutathione metabolic process
GO:0009410 response to xenobiotic stimulus
GO:0009635 response to herbicide
GO:0009751 response to salicylic acid
GO:0042542 response to hydrogen peroxide
Cellular Component
GO:0005737 cytoplasm
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1axd, PDBe:1axd, PDBj:1axd
PDBsum1axd
PubMed9417926
UniProtP12653|GSTF1_MAIZE Glutathione S-transferase 1 (Gene Name=GST1)

[Back to BioLiP]