Structure of PDB 1aw8 Chain B Binding Site BS01

Receptor Information
>1aw8 Chain B (length=91) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
cCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGA
AAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMK
Ligand information
>1aw8 Chain A (length=24) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MIRTMLQGKLHRVKVTHADLHYEG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1aw8 Crystal structure of aspartate decarboxylase at 2.2 A resolution provides evidence for an ester in protein self-processing.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		X25 A36 G37 I69 S70 V71 N72 G73 A76 H77 V81 G82 D83 I84 V85 I87 A88 S89 F90 V91 T92 M93 D95 A98 W101 P103 N104 A106 Y107 F108 N112
Binding residue
(residue number reindexed from 1)		X1 A12 G13 I45 S46 V47 N48 G49 A52 H53 V57 G58 D59 I60 V61 I63 A64 S65 F66 V67 T68 M69 D71 A74 W77 P79 N80 A82 Y83 F84 N88
Enzymatic activity
Catalytic site (original residue number in PDB) Y58
Catalytic site (residue number reindexed from 1) Y33
Enzyme Commision number 4.1.1.11: aspartate 1-decarboxylase.
Gene Ontology
Molecular Function
GO:0004068 aspartate 1-decarboxylase activity
Biological Process
GO:0006523 alanine biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1aw8, PDBe:1aw8, PDBj:1aw8
PDBsum1aw8
PubMed9546220
UniProtP0A790|PAND_ECOLI Aspartate 1-decarboxylase (Gene Name=panD)

[Back to BioLiP]