Structure of PDB 1aqc Chain B Binding Site BS01

Receptor Information
>1aqc Chain B (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIFAANYLGSTQLLNVRMMQAQEAVSRIKMAQKLATEVDLFILTQRIKVL
NADTQETMMDHPLRTISYIADIGNIVVLMARRRYKMICHVFESEDAQLIA
QSIGQAFSVAYQEFLRANGINP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1aqc Sequence-specific recognition of the internalization motif of the Alzheimer's amyloid precursor protein by the X11 PTB domain.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
R414 T415 I416 S417 Y418 I419 R431 A472 F479 Y483 F486
Binding residue
(residue number reindexed from 1)
R64 T65 I66 S67 Y68 I69 R81 A100 F107 Y111 F114
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1aqc, PDBe:1aqc, PDBj:1aqc
PDBsum1aqc
PubMed9321393
UniProtQ02410|APBA1_HUMAN Amyloid-beta A4 precursor protein-binding family A member 1 (Gene Name=APBA1)

[Back to BioLiP]