Structure of PDB 1aph Chain B Binding Site BS01

Receptor Information

>1aph Chain B (length=30) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Ligand information

>1aph Chain A (length=21) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GIVEQCCASVCSLYQLENYCN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1aph Conformational changes in cubic insulin crystals in the pH range 7-11.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	V2 N3 Q4 H5 L6 C7 L15 C19 R22 G23 F24 F25
Binding residue (residue number reindexed from 1)	V2 N3 Q4 H5 L6 C7 L15 C19 R22 G23 F24 F25

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005179	hormone activity

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:1aph, PDBe:1aph, PDBj:1aph
PDBsum	1aph
PubMed	1477273
UniProt	P01317\|INS_BOVIN Insulin (Gene Name=INS)

[Back to BioLiP]