Structure of PDB 1akh Chain B Binding Site BS01

Receptor Information
>1akh Chain B (length=78) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIK
NWVSNRRRKEKTITIAPELADLLSGEPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1akh Crystal structure of the MATa1/MATalpha2 homeodomain heterodimer in complex with DNA containing an A-tract.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y131 R132 G133 R135 Y156 K177 R184 R185 K188
Binding residue
(residue number reindexed from 1)		Y4 R5 G6 R8 Y29 K50 R57 R58 K61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1akh, PDBe:1akh, PDBj:1akh
PDBsum1akh
PubMed9838003
UniProtP0CY08|MTAL2_YEAST Mating-type protein ALPHA2 (Gene Name=MATALPHA2)

[Back to BioLiP]