Structure of PDB 1ais Chain B Binding Site BS01

Receptor Information
>1ais Chain B (length=193) Species: 2262 (Pyrococcus woesei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAA
CVYAACRLLKVPRTLDEIADIARVDKKEIGRSYRFIARNLNLTPKKLFVK
PTDYVNKFADELGLSEKVRRRAIEILDEAYKRGLTSGKSPAGLVAAALYI
ASLLEGEKRTQREVAEVARVTEVTVRNRYKELVEKLKIKVPIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ais The 2.1-A crystal structure of an archaeal preinitiation complex: TATA-box-binding protein/transcription factor (II)B core/TATA-box.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R1188 G1244 K1245 S1246 T1278 T1281 R1285
Binding residue
(residue number reindexed from 1)		R81 G137 K138 S139 T171 T174 R178
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0017025 TBP-class protein binding
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0070897 transcription preinitiation complex assembly

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ais, PDBe:1ais, PDBj:1ais
PDBsum1ais
PubMed9177165
UniProtP61999|TF2B_PYRWO Transcription initiation factor IIB (Gene Name=tfb)

[Back to BioLiP]