Structure of PDB 1abo Chain B Binding Site BS01

Receptor Information

>1abo Chain B (length=58) Species: 10090 (Mus musculus)

NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPS
NYITPVNS

Ligand information

>1abo Chain D (length=10) Species: 10090 (Mus musculus)

APTMPPPLPP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1abo High-resolution crystal structures of tyrosine kinase SH3 domains complexed with proline-rich peptides.
• Resolution: 2.0 Å
• Binding residue (original residue number in PDB): Y70 D77 E98 W99 W110 N114 Y115
• Binding residue (residue number reindexed from 1): Y7 D14 E35 W36 W47 N51 Y52

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

External links

• PDB: RCSB:1abo, PDBe:1abo, PDBj:1abo
• PDBsum: 1abo
• PubMed: 7664083
• UniProt: P00520|ABL1_MOUSE Tyrosine-protein kinase ABL1 (Gene Name=Abl1)