Structure of PDB 1a74 Chain B Binding Site BS01

Receptor Information
>1a74 Chain B (length=162) Species: 5791 (Physarum polycephalum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYG
VGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASHLCH
NTRCHNPLHLCWESLDDNKGRNWCPGPNGGCVHAVVCLRQGPLYGPGATV
AGPQQRGSHFVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a74 DNA binding and cleavage by the nuclear intron-encoded homing endonuclease I-PpoI.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
N57 R61 Q63 R74 G76 T95 A96 H98 L116 N119 N123
Binding residue
(residue number reindexed from 1)
N56 R60 Q62 R73 G75 T94 A95 H97 L115 N118 N122
Enzymatic activity
Catalytic site (original residue number in PDB) N119
Catalytic site (residue number reindexed from 1) N118
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1a74, PDBe:1a74, PDBj:1a74
PDBsum1a74
PubMed9665136
UniProtQ94702|PPO1_PHYPO Intron-encoded endonuclease I-PpoI

[Back to BioLiP]