Structure of PDB 1a73 Chain B Binding Site BS01

Receptor Information
>1a73 Chain B (length=162) Species: 5791 (Physarum polycephalum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYG
VGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASHLCH
NTRCHNPLHLCWESLDDNKGRNWCPGPNGGCVHAVVCLRQGPLYGPGATV
AGPQQRGSHFVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a73 DNA binding and cleavage by the nuclear intron-encoded homing endonuclease I-PpoI.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		L116 N123
Binding residue
(residue number reindexed from 1)		L115 N122
Enzymatic activity
Catalytic site (original residue number in PDB) N119
Catalytic site (residue number reindexed from 1) N118
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1a73, PDBe:1a73, PDBj:1a73
PDBsum1a73
PubMed9665136
UniProtQ94702|PPO1_PHYPO Intron-encoded endonuclease I-PpoI

[Back to BioLiP]