Structure of PDB 1a6a Chain B Binding Site BS01

Receptor Information
>1a6a Chain B (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELG
RPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVYPS
KTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWT
FQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a6a The structure of an intermediate in class II MHC maturation: CLIP bound to HLA-DR3.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		Y30 F47 P56 D57 Y60 W61 K71 R74 N77 Y78 H81 N82 V85 V86
Binding residue
(residue number reindexed from 1)		Y26 F43 P52 D53 Y56 W57 K67 R70 N73 Y74 H77 N78 V81 V82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1a6a, PDBe:1a6a, PDBj:1a6a
PDBsum1a6a
PubMed7477400
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]