Structure of PDB 1a5h Chain B Binding Site BS01

Receptor Information
>1a5h Chain B (length=252) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALL
QLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYS
ERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQ
GDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNM
RP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a5h Structural mapping of the active site specificity determinants of human tissue-type plasminogen activator. Implications for the design of low molecular weight substrates and inhibitors.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		S26 H27 W29 R119 T120 C122 E137 R206 M207
Binding residue
(residue number reindexed from 1)		S11 H12 W14 R117 T118 C120 E135 R214 M215
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H47 D96 Q200 G201 D202 S203 G204
Enzyme Commision number 3.4.21.68: t-plasminogen activator.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1a5h, PDBe:1a5h, PDBj:1a5h
PDBsum1a5h
PubMed9268299
UniProtP00750|TPA_HUMAN Tissue-type plasminogen activator (Gene Name=PLAT)

[Back to BioLiP]