Structure of PDB 1a3q Chain B Binding Site BS01

Receptor Information

>1a3q Chain B (length=285) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYE
GPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNL
GVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMD
LSIVRLRFSAFLRSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRG
GDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTP
PYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYP

Ligand information

>1a3q Chain C (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggggaatcccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1a3q Structure of the human NF-kappaB p52 homodimer-DNA complex at 2.1 A resolution.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	R52 R54 K221
Binding residue (residue number reindexed from 1)	R16 R18 K179

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1a3q, PDBe:1a3q, PDBj:1a3q
PDBsum	1a3q
PubMed	9384586
UniProt	Q00653\|NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit (Gene Name=NFKB2)

[Back to BioLiP]