Structure of PDB 1a38 Chain B Binding Site BS01

Receptor Information
>1a38 Chain B (length=216) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKN
VVGARRSSWRVVSSIEQEKKQQMAREYREKIETELRDICNDVLSLLEKFL
IPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEI
SKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAESYK
DSTLIMQLLRDNLTLW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a38 14-3-3zeta binds a phosphorylated Raf peptide and an unphosphorylated peptide via its conserved amphipathic groove.
Resolution3.35 Å
Binding residue
(original residue number in PDB)		K49 R60 K120 L220
Binding residue
(residue number reindexed from 1)		K49 R60 K115 L208
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0050815 phosphoserine residue binding
GO:0140311 protein sequestering activity
Biological Process
GO:0006468 protein phosphorylation
GO:0007165 signal transduction
GO:0008104 protein localization
GO:0070372 regulation of ERK1 and ERK2 cascade
Cellular Component
GO:0005737 cytoplasm
GO:0042470 melanosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1a38, PDBe:1a38, PDBj:1a38
PDBsum1a38
PubMed9632691
UniProtP63103|1433Z_BOVIN 14-3-3 protein zeta/delta (Gene Name=YWHAZ)

[Back to BioLiP]