Structure of PDB 1a37 Chain B Binding Site BS01

Receptor Information

>1a37 Chain B (length=195) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKN
VVGARRSSWRVVSSIEQEKKQQMAREYREKIETELRDICNDVLSLLEKFL
IPNAAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISK
IRLGLALNFSVFYYACSLAKTAFDEAIADDSTLIMQLLRDNLTLW

Ligand information

>1a37 Chain Q (length=7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RSTSTPN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1a37 14-3-3zeta binds a phosphorylated Raf peptide and an unphosphorylated peptide via its conserved amphipathic groove.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	K49 R56 R127 Y128 L172 N173
Binding residue (residue number reindexed from 1)	K49 R56 R120 Y121 L157 N158

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0050815	phosphoserine residue binding
GO:0140311	protein sequestering activity

	Biological Process
GO:0006468	protein phosphorylation
GO:0007165	signal transduction
GO:0008104	protein localization
GO:0070372	regulation of ERK1 and ERK2 cascade

	Cellular Component
GO:0005737	cytoplasm
GO:0042470	melanosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1a37, PDBe:1a37, PDBj:1a37
PDBsum	1a37
PubMed	9632691
UniProt	P63103\|1433Z_BOVIN 14-3-3 protein zeta/delta (Gene Name=YWHAZ)

[Back to BioLiP]