Structure of PDB 8apn Chain Ar Binding Site BS01

Receptor Information
>8apn Chain Ar (length=155) Species: 353565 (Polytomella magna) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DYLLDDDINGDPSNPLNKPMHFGSFQKQRQPNSFRRLPICFPDIKLTLMK
LEEHQLEQIKQTGWLREAAFKTTPNTTKLEIKAFLESVYGMEVERVNTAN
YLGRKRVVYTGKAKELYREDDYKKAYVIFKKPEGLSLPETRPLLQKLVDI
KLKRK
Ligand information
>8apn Chain A6 (length=109) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcagguagcagaacguucuauauaauagaauugcuaaugcugguauaagu
aacuauguaaaaauacagcuaagcuaaagguuuugcgcaacagugaaacg
auaaaguaa
.............<.<<<<<<...>>>>>>..>.................
......<<......>>.................<<.....>>........
.........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8apn Structure of a mitochondrial ribosome with fragmented rRNA in complex with membrane-targeting elements.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Q79 E118 K129 N148 T149 Y152 R155 K175 Y177 K213
Binding residue
(residue number reindexed from 1)		Q28 E67 K78 N97 T98 Y101 R104 K124 Y126 K155
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Feb 21 22:43:41 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8apn', asym_id = 'Ar', bs = 'BS01', title = 'Structure of a mitochondrial ribosome with fragm...rRNA in complex with membrane-targeting elements.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8apn', asym_id='Ar', bs='BS01', title='Structure of a mitochondrial ribosome with fragm...rRNA in complex with membrane-targeting elements.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8apn', asym_id = 'Ar'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8apn', asym_id='Ar')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>