Structure of PDB 7nsj Chain Ah Binding Site BS01

Receptor Information
>7nsj Chain Ah (length=120) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLWDIEFAKQLAAVTERPFQNGFEEMIQWTKEGKLWEFPINNEAGFDDDG
SEFHEHIFLDKYLQDFPKQGPIRHFMELVTCGLSKNPYLSVKQKVEHIEW
FRNYFNEKRVILKESGIQLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nsj Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		F320 H321 F325
Binding residue
(residue number reindexed from 1)		F53 H54 F58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005739 mitochondrion
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7nsj, PDBe:7nsj, PDBj:7nsj
PDBsum7nsj
PubMed33878294
UniProtA0A4X1SQW0

[Back to BioLiP]