Structure of PDB 5aj4 Chain Ah Binding Site BS01

Receptor Information
>5aj4 Chain Ah (length=103) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PFQNGFEEMIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLDKYLQDFP
KQGPIRHFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNEKRVILKESGI
QLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5aj4 The complete structure of the 55S mammalian mitochondrial ribosome.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		H321 F325
Binding residue
(residue number reindexed from 1)		H37 F41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005763 mitochondrial small ribosomal subunit

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5aj4, PDBe:5aj4, PDBj:5aj4
PDBsum5aj4
PubMed25837512
UniProtF1RME2

[Back to BioLiP]