Structure of PDB 7uio Chain Ag Binding Site BS01

Receptor Information

>7uio Chain Ag (length=171) Species: 559292 (Saccharomyces cerevisiae S288C)

SLYPPPPPYVKFFTQSNLEKLPKYKEKKAASAKEEEITCALDYLIPPPMP
KNQQYRAFGSIWQENESNYQYKIQELRKLLKSLLLNYLELIGVLSINPDM
YERKVENIRTILVNIHHLLNEYRPHQSRESLIMLLEEQLEYKRGEIREIE
QVCKQVHDKLTSIQDTLRTGS

Ligand information

>7uio Chain Az (length=25) Species: 559292 (Saccharomyces cerevisiae S288C)

PSYSPTSPSYSPTSPSYSPTSPSYS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7uio Structural basis of a transcription pre-initiation complex on a divergent promoter.
• Resolution: 3.3 Å
• Binding residue (original residue number in PDB): S11 L12
• Binding residue (residue number reindexed from 1): S1 L2

Gene Ontology

Molecular Function

• GO:0003712 transcription coregulator activity
• GO:0003713 transcription coactivator activity
• GO:0005515 protein binding

Biological Process

• GO:0000122 negative regulation of transcription by RNA polymerase II
• GO:0006357 regulation of transcription by RNA polymerase II
• GO:0032968 positive regulation of transcription elongation by RNA polymerase II
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:0051123 RNA polymerase II preinitiation complex assembly
• GO:0060261 positive regulation of transcription initiation by RNA polymerase II

Cellular Component

• GO:0005634 nucleus
• GO:0016592 mediator complex
• GO:0070847 core mediator complex

External links

• PDB: RCSB:7uio, PDBe:7uio, PDBj:7uio
• PDBsum: 7uio
• PubMed: 36731470
• UniProt: Q08278|MED7_YEAST Mediator of RNA polymerase II transcription subunit 7 (Gene Name=MED7)