Structure of PDB 8fmw Chain Ac Binding Site BS01

Receptor Information
>8fmw Chain Ac (length=81) Species: 224326 (Borreliella burgdorferi B31) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRKDIHPKNNLVVFKDGSNGAMFLTKSTLNSKETIKYIDGKEYPLVTVEI
TSKSHPFYTGQQKFVDAAGRIDKFNKRYKKS
Ligand information
>8fmw Chain AB (length=112) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cccuggugguuaaagaaaagaggaaacaccuguuaucauuccgaacacag
aaguuaagcucuuauucgcugaugguacugcgaguucgcgggagaguagg
uuauugccaggg
.<<<<<<<<.....<<.<<<<<.....<<<<<...............>>>
..>>....>>>>>..>><<<.......<<<<<....>>>>>.......>>
>..>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fmw The structure of a hibernating ribosome in a Lyme disease pathogen.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		M1 R2 H6
Binding residue
(residue number reindexed from 1)		M1 R2 H6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fmw, PDBe:8fmw, PDBj:8fmw
PDBsum8fmw
PubMed37907464
UniProtO51247|RL31B_BORBU Large ribosomal subunit protein bL31B (Gene Name=rpmE2)

[Back to BioLiP]